PDB entry 3zu8

View 3zu8 on RCSB PDB site
Description: structure of cbm3b of major scaffoldin subunit scaa from acetivibrio cellulolyticus determined on the nikel absorption edge
Class: sugar binding protein
Keywords: sugar binding protein, cellulosome
Deposited on 2011-07-17, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1554
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cellulosomal scaffoldin
  Species: Acetivibrio cellulolyticus [TaxId:35830]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9RPL0 (4-152)
    • expression tag (0-3)
  Domains in SCOPe 2.07: d3zu8a1, d3zu8a2
• Heterogens: CA, EDO, NI, 1PE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3zu8A (A:)
  gshmnlkveffnagtqaqsnsiypkfrltntgsnainladvklhyyftvdgdkaqtfwcd
  wspvgssnvtgtfvkmnptttgadqyleiafssaagtlaantsievqgrfaksdwtnynq
  addysfnssattytswdkvtaysaegliwgiep