PDB entry 3zsi

View 3zsi on RCSB PDB site
Description: X-ray structure of p38alpha bound to VX-745
Class: transferase
Keywords: transferase
Deposited on 2011-06-28, released 2012-06-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.23397
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3zsia_
  • Heterogens: 52P, BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zsiA (A:)
    gshsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrp
    fqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivk
    cqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtdde
    mtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrl
    vgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkrit
    aaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeem
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zsiA (A:)
    ptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiiha
    krtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnikltddhvqf
    liyqilrglkyihsadiihrdlkpsnlavnedcelkildfgltrwyrapeimlnwmhynq
    tvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsl
    kmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqs
    fesrdllidewksltydevisfvppp