PDB entry 3zs5

View 3zs5 on RCSB PDB site
Description: Structural basis for kinase selectivity of three clinical p38alpha inhibitors
Class: transferase
Keywords: transferase, tak-715, scio-469, vx-745, sb-203580
Deposited on 2011-06-23, released 2012-07-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-15, with a file datestamp of 2012-08-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18586
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.04: d3zs5a_
  • Heterogens: SB2, BOG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zs5A (A:)
    gshsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrp
    fqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivk
    cqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtdde
    mtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrl
    vgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkrit
    aaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeem
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zs5A (A:)
    hsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglatrwyrape
    imlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkiss
    esarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyh
    dpddepvadpydqsfesrdllidewksltydevisfvppp