PDB entry 3zs4

View 3zs4 on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound prfar
Class: isomerase
Keywords: isomerase, aromatic amino acid biosynthesis, tryptophan biosynthesis, tim barrel, histidine biosynthesis
Deposited on 2011-06-22, released 2012-07-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17632
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosyl isomerase a
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zs4a_
  • Heterogens: 1PR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zs4A (A:)
    mplillpavdvvegravrlvqgkagsqteygsavdaalgwqrdgaewihlvdldaafgrg
    snhellaevvgkldvqvelsggirddeslaaalatgcarvnvgtaalenpqwcarvigeh
    gdqvavgldvqiidgehrlrgrgwetdggdlwdvlerldsegcsrfvvtditkdgtlggp
    nldllagvadrtdapviasggvsslddlraiatlthrgvegaivgkalyarrftlpqala
    avrd