PDB entry 3zs4

View 3zs4 on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase with bound prfar
Class: isomerase
Keywords: isomerase, aromatic amino acid biosynthesis, tryptophan biosynthesis, tim barrel, histidine biosynthesis
Deposited on 2011-06-22, released 2012-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-07-11, with a file datestamp of 2012-07-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.17632
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphoribosyl isomerase a
  Species: Mycobacterium tuberculosis [TaxId:83332]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60578 (0-243)
  Domains in SCOPe 2.08: d3zs4a_
• Heterogens: 1PR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3zs4A (A:)
  mplillpavdvvegravrlvqgkagsqteygsavdaalgwqrdgaewihlvdldaafgrg
  snhellaevvgkldvqvelsggirddeslaaalatgcarvnvgtaalenpqwcarvigeh
  gdqvavgldvqiidgehrlrgrgwetdggdlwdvlerldsegcsrfvvtditkdgtlggp
  nldllagvadrtdapviasggvsslddlraiatlthrgvegaivgkalyarrftlpqala
  avrd