PDB entry 3zrs

View 3zrs on RCSB PDB site
Description: X-ray crystal structure of a KirBac potassium channel highlights a mechanism of channel opening at the bundle-crossing gate.
Class: metal transport
Keywords: metal transport, ion channel, inward rectifier, membrane protein, kir channel
Deposited on 2011-06-17, released 2012-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: 0.2222
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-sensitive inward rectifier potassium channel 10
    Species: Magnetospirillum magnetotacticum [TaxId:188]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9N164
      • engineered mutation (128)
    Domains in SCOPe 2.06: d3zrsa1, d3zrsa2, d3zrsa3
  • Heterogens: CL, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zrsA (A:)
    mtggmkpparkprilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvt
    nalfalaylacgdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcg
    mlglavaarliyarftrptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvl
    vrseisqegmvfrrfhdltltrsrspifslswtvmhpidhhspiygetdetlrnshsefl
    vlftghheafaqnvharhayscdeiiwgghfvdvfttlpdgrraldlgkfheiaqhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zrsA (A:)
    prilnsdgssnitrlwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvien
    arpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaarliyarftr
    ptagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhd
    ltltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvhar
    hayscdeiiwgghfvdvfttgrraldlgkfheiaqhhhhh