PDB entry 3zr9

View 3zr9 on RCSB PDB site
Description: structure of new delhi metallo-beta-lactamase 1 (ndm-1)
Class: hydrolase
Keywords: hydrolase
Deposited on 2011-06-15, released 2011-06-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.1815
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase NDM-1
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C7C422 (2-230)
      • expression tag (0-1)
    Domains in SCOPe 2.02: d3zr9a_
  • Heterogens: ZN, CO, NI, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3zr9A (A:)
gpgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqta
qilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqh
sltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslg
nlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr