PDB entry 3zqu

View 3zqu on RCSB PDB site
Description: structure of a probable aromatic acid decarboxylase
Class: lyase
Keywords: lyase
Deposited on 2011-06-11, released 2011-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.17258
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable aromatic acid decarboxylase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zqua_
  • Heterogens: FNR, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zquA (A:)
    msgperitlamtgasgaqyglrlldclvqeerevhfliskaaqlvmatetdvalpakpqa
    mqaflteycgaaagqirvfgqndwmappasgssapnamvicpcstgtlsavatgacnnli
    eraadvalkerrplvlvpreapfssihlenmlklsnlgavilpaapgfyhqpqsvedlvd
    fvvarilntlgipqdmlprwgeqhlvsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zquA (A:)
    msgperitlamtgasgaqyglrlldclvqeerevhfliskaaqlvmatetdvalpakpqa
    mqaflteycgaaagqirvfgqndwmappasgssapnamvicpcstgtlsavatgacnnli
    eraadvalkerrplvlvpreapfssihlenmlklsnlgavilpaapgfyhqpqsvedlvd
    fvvarilntlgipqdmlprwgeqhlvs