PDB entry 3zqt

View 3zqt on RCSB PDB site
Description: targeting the binding function 3 site of the androgen receptor through in silico molecular modeling
Class: transcription
Keywords: transcription, small molecule inhibitor
Deposited on 2011-06-10, released 2011-12-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.2324
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Androgen receptor
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3zqta_
  • Heterogens: TES, SO4, 30Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zqtA (A:)
    iegyecqpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalp
    gfrnlhvddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysq
    cvrmrhlsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriia
    ckrknptscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqv
    pkilsgkvkpiyfhtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zqtA (A:)
    qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
    vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
    lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
    tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
    kvkpiyfhtq