PDB entry 3zqd

View 3zqd on RCSB PDB site
Description: B. subtilis L,D-transpeptidase
Class: transferase
Keywords: transferase, peptidoglycan, antibiotic resistance, cysteine protease
Deposited on 2011-06-09, released 2012-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l, d-transpeptidase ykud
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34816 (4-166)
      • expression tag (0-3)
      • expression tag (167-168)
    Domains in SCOPe 2.07: d3zqda1, d3zqda2, d3zqda3, d3zqda4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zqdA (A:)
    grklltyqvkqgdtlnsiaadfristaallqanpslqagltagqsivipglpdpytipyh
    iavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpfgaywlslsk
    qhygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zqdA (A:)
    grklltyqvkqgdtlnsiaadfristaallqanpslqagltagqsivipglpdpytipyh
    iavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpfgaywlslsk
    qhygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinrgs