PDB entry 3zq7

View 3zq7 on RCSB PDB site
Description: The Structure of DNA-binding domain of response regulator from Escherichia coli K-12
Class: transcription
Keywords: transcription, response regulator
Deposited on 2011-06-08, released 2012-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KDP operon transcriptional regulatory protein kdpE
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3zq7a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3zq7A (A:)
apdplvkfsdvtvdlaarvihrgeeevhltpiefrllavllnnagkvltqrqllnqvwgp
navehshylriymghlrqkleqdparprhfitetgigyrfml

    Sequence, based on observed residues (ATOM records): (download) 
    >3zq7A (A:)
pdplvkfsdvtvdlaarvihrgeeevhltpiefrllavllnnagkvltqrqllnqvwgpn
avehshylriymghlrqkleqdparprhfitetgigyrfml