PDB entry 3zpd

View 3zpd on RCSB PDB site
Description: Solution structure of the FimH adhesin carbohydrate-binding domain
Class: cell adhesion
Keywords: cell adhesion, bacterial adhesin, urinary tract infection, carbohydrate
Deposited on 2013-02-27, released 2014-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FimH
    Species: ESCHERICHIA COLI [TaxId:1206108]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zpda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zpdA (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt