PDB entry 3zp7

View 3zp7 on RCSB PDB site
Description: Arg90Cit chorismate mutase of Bacillus subtilis in complex with chorismate and prephenate
Class: isomerase
Keywords: isomerase, pseudo-alpha beta-barrel, non-proteinogenic amino acid, semi-synthetic, reaction mechanism
Deposited on 2013-02-26, released 2014-04-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.1677
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chorismate mutase aroh
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19080 (0-End)
    • engineered mutation (101)
    • variant (111)
  Domains in SCOPe 2.05: d3zp7a_
• Chain 'B':
  Compound: chorismate mutase aroh
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19080 (0-End)
    • engineered mutation (101)
    • variant (111)
• Chain 'C':
  Compound: chorismate mutase aroh
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19080 (0-End)
    • engineered mutation (101)
    • variant (111)
• Chain 'D':
  Compound: chorismate mutase aroh
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19080 (0-End)
    • engineered mutation (101)
    • variant (111)
  Domains in SCOPe 2.05: d3zp7d_
• Chain 'E':
  Compound: chorismate mutase aroh
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19080 (0-End)
    • engineered mutation (101)
    • variant (111)
• Chain 'F':
  Compound: chorismate mutase aroh
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19080 (0-End)
    • engineered mutation (101)
    • variant (111)
• Heterogens: PRE, ISJ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3zp7A (A:)
  mmirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpak
  avrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqeqirhvylekavvlrpdls
  ltkntel
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3zp7A (A:)
  mmirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpak
  avrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqeqirhvylekavvlrp
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >3zp7D (D:)
  mmirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpak
  avrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqeqirhvylekavvlrpdls
  ltkntel
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3zp7D (D:)
  mmirgirgattverdteeeilqktkqllekiieenhtkpedvvqmllsatpdlhavfpak
  avrelsgwqyvpvtcmqemdvtgglkkcirvmmtvqtdvpqeqirhvylekavvlrp
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.