PDB entry 3zp3

View 3zp3 on RCSB PDB site
Description: INFLUENZA VIRUS (VN1194) H5 HA A138V mutant with LSTc
Class: viral protein
Keywords: viral protein
Deposited on 2013-02-26, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.23794
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Haemagglutinin
    Species: INFLUENZA A VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ34
      • conflict (51)
      • engineered mutation (149)
    Domains in SCOPe 2.07: d3zp3e_
  • Chain 'F':
    Compound: Haemagglutinin
    Species: INFLUENZA A VIRUS [TaxId:644788]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zp3f_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3zp3E (E:)
    mekivllfaivslvksdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdl
    dgvkplilrdcsvagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhl
    lsrinhfekiqiipksswssheaslgvssvcpyqgkssffrnvvwlikknstyptikrsy
    nntnqedllvlwgihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsg
    rmeffwtilkpndainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmga
    inssmpfhnihpltigecpkyvksnrlvlatglrnspqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zp3E (E:)
    dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssvcpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3zp3F (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zp3F (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtyd