PDB entry 3zp0

View 3zp0 on RCSB PDB site
Description: INFLUENZA VIRUS (VN1194) H5 HA with LSTa
Class: viral protein
Keywords: viral protein
Deposited on 2013-02-26, released 2013-10-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.24385
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DQ34
      • conflict (51)
    Domains in SCOPe 2.06: d3zp0e_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zp0f_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3zp0E (E:)
    mekivllfaivslvksdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdl
    dgvkplilrdcsvagwllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhl
    lsrinhfekiqiipksswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsy
    nntnqedllvlwgihhpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsg
    rmeffwtilkpndainfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmga
    inssmpfhnihpltigecpkyvksnrlvlatglrnspqre
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zp0E (E:)
    dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
    llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
    swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
    pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
    fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
    ecpkyvksnrlvlatglrnsp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3zp0F (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zp0F (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesvrngtyd