PDB entry 3zoh

View 3zoh on RCSB PDB site
Description: Crystal structure of FMN-binding protein (YP_005476) from Thermus thermophilus with bound 1-Cyclohex-2-enone
Class: fmn-binding protein
Keywords: fmn-binding protein, cyclohexenone
Deposited on 2013-02-21, released 2014-05-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: 0.16236
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavoredoxin
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3zoha_
  • Chain 'B':
    Compound: flavoredoxin
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3zohb_
  • Chain 'C':
    Compound: flavoredoxin
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3zohc_
  • Chain 'D':
    Compound: flavoredoxin
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3zohd_
  • Heterogens: A2Q, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zohA (A:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zohB (B:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zohC (C:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zohD (D:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap