PDB entry 3zof

View 3zof on RCSB PDB site
Description: Crystal structure of FMN-binding protein (YP_005476) from Thermus thermophilus with bound benzene-1,4-diol
Class: fmn-binding protein
Keywords: fmn-binding protein
Deposited on 2013-02-21, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.19455
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavoredoxin
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zofa_
  • Chain 'B':
    Compound: flavoredoxin
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zofb_
  • Heterogens: HQE, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3zofA (A:)
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3zofB (B:)
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap