PDB entry 3zoe

View 3zoe on RCSB PDB site
Description: Crystal structure of FMN-binding protein (YP_005476) from Thermus thermophilus with bound p-hydroxybenzaldehyde
Class: fmn-binding protein
Keywords: fmn-binding protein
Deposited on 2013-02-21, released 2014-05-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.24381000000000003
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavoredoxin
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3zoea_
  • Chain 'B':
    Compound: flavoredoxin
    Species: Thermus thermophilus [TaxId:262724]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3zoeb_
  • Heterogens: HBA, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zoeA (A:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zoeA (A:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglldrpkpglallyygkglygrpaeetfap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zoeB (B:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zoeB (B:)
    mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
    hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
    ellevhtfgdhdlfvgrvvavweeeglkgrpkpglallyygkglygrpaeetfap