PDB entry 3zob

View 3zob on RCSB PDB site
Description: Solution structure of chicken Engrailed 2 homeodomain
Class: DNA-binding protein
Keywords: DNA-binding protein, cell-penetrating peptide
Deposited on 2013-02-21, released 2013-08-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homeobox protein engrailed-2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q05917 (5-64)
      • expression tag (0-4)
      • expression tag (65-66)
    Domains in SCOPe 2.05: d3zoba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3zobA (A:)
gpmasdkrprtaftaeqlqrlkaefqtnrylteqrrqslaqelglnesqikiwfqnkrak
ikkatqa