PDB entry 3zo5

View 3zo5 on RCSB PDB site
Description: Structure of SENP2-Loop1 in complex with preSUMO-2
Class: hydrolase/signaling protein
Keywords: hydrolase-signaling protein complex
Deposited on 2013-02-20, released 2014-01-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.19041
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sentrin-specific protease 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HC62 (43-237)
      • insertion (35-42)
      • engineered mutation (196)
    Domains in SCOPe 2.03: d3zo5a_
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61956 (3-82)
      • expression tag (83)
    Domains in SCOPe 2.03: d3zo5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zo5A (A:)
    gshmaddlleltedmekeisnalghgpqdeilssappppakgglritrgdiqtlknyhwl
    ndevinfymnllvernkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilv
    pihrkvhwslvvidlrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewth
    hsmkpheipqqlngsdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zo5A (A:)
    leltedmekeisnalghgpqdeilssappppakgglritrgdiqtlknyhwlndevinfy
    mnllvernkkqgypalhvfstffypklksggyqavkrwtkgvnlfeqeiilvpihrkvhw
    slvvidlrkkclkyldsmgqkghriceillqylqdesktkrnsdlnllewthhsmkphei
    pqqlngsdsgmftckyadyisrdkpitftqhqmplfrkkmvweilhqqll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zo5B (B:)
    mandhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdt
    paqlemededtidvfqqqtggvylehhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zo5B (B:)
    dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
    lemededtidvfqqqtggvyl