PDB entry 3zns

View 3zns on RCSB PDB site
Description: HDAC7 bound with TFMO inhibitor tmp942
Class: hydrolase
Keywords: hydrolase, zbg, mbg
Deposited on 2013-02-15, released 2013-03-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.18814
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone deacetylase 7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3znsa_
  • Chain 'B':
    Compound: histone deacetylase 7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3znsb_
  • Chain 'C':
    Compound: histone deacetylase 7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3znsc_
  • Heterogens: ZN, K, NU7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3znsA (A:)
    gsraqsspaapaslsapepasqarvlsssetpartlpfttgliydsvmlkhqcscgdnsr
    hpehagriqsiwsrlqerglrsqceclrgrkasleelqsvhserhvllygtnplsrlkld
    ngklagllaqrmfvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkng
    favvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyq
    dpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafri
    vvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlale
    gghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmqr
    las
    

    Sequence, based on observed residues (ATOM records): (download)
    >3znsA (A:)
    lpfttgliydsvmlkhqcscgdnsrhpehagriqsiwsrlqerglrsqceclrgrkasle
    elqsvhserhvllygtnplsvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkva
    srelkngfavvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgng
    tqqtfyqdpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpe
    ylaafrivvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlagg
    avvlalegghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhsk
    ywgcmqrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3znsB (B:)
    gsraqsspaapaslsapepasqarvlsssetpartlpfttgliydsvmlkhqcscgdnsr
    hpehagriqsiwsrlqerglrsqceclrgrkasleelqsvhserhvllygtnplsrlkld
    ngklagllaqrmfvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkng
    favvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyq
    dpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafri
    vvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlale
    gghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmqr
    las
    

    Sequence, based on observed residues (ATOM records): (download)
    >3znsB (B:)
    fttgliydsvmlkhqcscgdnsrhpehagriqsiwsrlqerglrsqceclrgrkasleel
    qsvhserhvllygtnplsrlkldngklagllaqvmlpcggvgvdtdtiwnelhssnaarw
    aagsvtdlafkvasrelkngfavvrppghhadhstamgfcffnsvaiacrqlqqqskask
    ilivdwdvhhgngtqqtfyqdpsvlyislhrhddgnffpgsgavdevgagsgegfnvnva
    waggldppmgdpeylaafrivvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcf
    gymtqqlmnlaggavvlalegghdltaicdaseacvaallgnrvdplseegwkqkpnlna
    irsleavirvhskywgcmqr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3znsC (C:)
    gsraqsspaapaslsapepasqarvlsssetpartlpfttgliydsvmlkhqcscgdnsr
    hpehagriqsiwsrlqerglrsqceclrgrkasleelqsvhserhvllygtnplsrlkld
    ngklagllaqrmfvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkng
    favvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyq
    dpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafri
    vvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlale
    gghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmqr
    las
    

    Sequence, based on observed residues (ATOM records): (download)
    >3znsC (C:)
    ttgliydsvmlkhqcscgdnsrhpehagriqsiwsrlqerglrsqceclrgrkasleelq
    svhserhvllygtnplpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkng
    favvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyq
    dpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafri
    vvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlale
    gghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmq