PDB entry 3znf

View 3znf on RCSB PDB site
Description: high-resolution three-dimensional structure of a single zinc finger from a human enhancer binding protein in solution
Class: zinc finger DNA binding domain
Keywords: zinc finger DNA binding domain
Deposited on 1990-07-09, released 1992-01-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: zinc finger
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15822 (0-29)
    • conflict (5)
  Domains in SCOPe 2.01: d3znfa_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3znfA (A:)
  rpyhcsycnfsfktkgnltkhmkskahskk