PDB entry 3zlz

View 3zlz on RCSB PDB site
Description: Lys6-linked tri-ubiquitin
Class: signaling protein
Keywords: signaling protein, atypical chain type, deubiquitinase, nlel, bacterial effector
Deposited on 2013-02-04, released 2013-04-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2542
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-End)
      • engineered mutation (47)
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG47 (0-End)
      • engineered mutation (47)
    Domains in SCOPe 2.02: d3zlzb_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3zlzB (B:)
mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlrgg

    Sequence, based on observed residues (ATOM records): (download) 
    >3zlzB (B:)
mqifvktlktitlevepsdtienvkakiqdkegippdqqrlifagrqledgrtlsdyniq
kestlhlvlrl