PDB entry 3zlx

View 3zlx on RCSB PDB site
Description: Crystal structure of MEK1 in complex with fragment 18
Class: transferase
Keywords: transferase
Deposited on 2013-02-04, released 2013-05-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2053
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zlxa_
  • Heterogens: 5EZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zlxA (A:)
    gleeleldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvma
    rklihleikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvl
    kkagripeqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgql
    idsmansfvgtrsymsperlqgthysvqsdiwsmglslvemavgrypipppdakelelmf
    gcqvegdaaetpprprtpgrplnkkgmdsrppmaifelldyivnepppklpsgvfslefq
    dfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstiglnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zlxA (A:)
    eleldeqqrkrleafltqkqkvgelkdddfekiselgagnggvvfkvshkpsglvmarkl
    ihleikpairnqiirelqvlhecnspyivgfygafysdgeisicmehmdggsldqvlkka
    gripeqilgkvsiavikgltylrekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlids
    mavgtrsymsperlqgthysvqsdiwsmglslvemavgrypipppdakelelmfgcpmai
    felldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhafikrsdaeevd
    fagwlcstigln