PDB entry 3zlq

View 3zlq on RCSB PDB site
Description: bace2 xaperone complex
Class: hydrolase/immune system
Keywords: hydrolase-immune system complex
Deposited on 2013-02-04, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.24123
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zlqa_
  • Chain 'B':
    Compound: Beta-secretase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zlqb_
  • Chain 'C':
    Compound: xa4813
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZLQ (0-End)
    Domains in SCOPe 2.07: d3zlqc1, d3zlqc2
  • Chain 'D':
    Compound: xa4813
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZLQ (0-End)
    Domains in SCOPe 2.07: d3zlqd1, d3zlqd2
  • Heterogens: 6T9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zlqA (A:)
    anflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdter
    sstyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwn
    gilglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggi
    epslykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqk
    vfdavveavaraslipafsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfrit
    ilpqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspca
    eiagaavseisgpfstedvasncvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zlqA (A:)
    lamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdtersst
    yrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngil
    glayatlakpsssletffdslvtqanipnvfsmqmcgagggslvlggiepslykgdiwyt
    pikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveavara
    sdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqpmmgaglnye
    cyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavseisgpfsted
    vasncvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zlqB (B:)
    anflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdter
    sstyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwn
    gilglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggi
    epslykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqk
    vfdavveavaraslipafsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfrit
    ilpqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspca
    eiagaavseisgpfstedvasncvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zlqB (B:)
    flamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdterss
    tyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngi
    lglayatlakpsssletffdslvtqanipnvfsmqmcgagggslvlggiepslykgdiwy
    tpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveavar
    aslidgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqpmmgagl
    nyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavseisgpfs
    tedvasncvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zlqC (C:)
    qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
    adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvsshhhhhhep
    ea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zlqC (C:)
    qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
    adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zlqD (D:)
    qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
    adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvsshhhhhhep
    ea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zlqD (D:)
    qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
    adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvss