PDB entry 3zlh

View 3zlh on RCSB PDB site
Description: Structure of group A Streptococcal enolase
Class: lyase
Keywords: lyase, plasminogen-binding
Deposited on 2013-01-31, released 2014-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: STREPTOCOCCUS PYOGENES MGAS10394 [TaxId:286636]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5XD01 (20-End)
      • expression tag (19)
    Domains in SCOPe 2.07: d3zlha1, d3zlha2, d3zlha3
  • Chain 'B':
    Compound: enolase
    Species: STREPTOCOCCUS PYOGENES MGAS10394 [TaxId:286636]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5XD01 (20-End)
      • expression tag (19)
    Domains in SCOPe 2.07: d3zlhb1, d3zlhb2, d3zlhb3
  • Chain 'C':
    Compound: enolase
    Species: STREPTOCOCCUS PYOGENES MGAS10394 [TaxId:286636]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5XD01 (20-End)
      • expression tag (19)
    Domains in SCOPe 2.07: d3zlhc1, d3zlhc2, d3zlhc3
  • Chain 'D':
    Compound: enolase
    Species: STREPTOCOCCUS PYOGENES MGAS10394 [TaxId:286636]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5XD01 (20-End)
      • expression tag (19)
    Domains in SCOPe 2.07: d3zlhd1, d3zlhd2, d3zlhd3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zlhA (A:)
    mgsshhhhhhssglvprgshmsiitdvyarevldsrgnptlevevytesgafgrgmvpsg
    astgeheavelrdgdksrylglgtqkavdnvnniiakaiigydvrdqqaidramialdgt
    pnkgklganailgvsiavaraaadylevplytylggfntkvlptpmmniinggshsdapi
    afqefmimpvgaptfkeglrwgaevfhalkkilkerglvtavgdeggfapkfegtedgve
    tilkaieaagyeagengimigfdcassefydkerkvydytkfegegaavrtsaeqvdyle
    elvnkypiitiedgmdendwdgwkvlterlgkrvqlvgddffvtnteylargikenaans
    ilikvnqigtltetfeaiemakeagytavvshrsgetedstiadiavatnagqiktgsls
    rtdriakynqllriedqlgevaqykgiksfynlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zlhA (A:)
    hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgeheavelrdgdksrylglg
    tqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavaraaa
    dylevplytylggfntkvlptpmmniinggshsdapiafqefmimpvgaptfkeglrwga
    evfhalkkilkerglvtavgdeggfapkfegtedgvetilkaieaagyeagengimigfd
    cassefydkerkvydytkfegegaavrtsaeqvdyleelvnkypiitiedgmdendwdgw
    kvlterlgkrvqlvgddffvtnteylargikenaansilikvnqigtltetfeaiemake
    agytavvshrsgetedstiadiavatnagqiktgslsrtdriakynqllriedqlgevaq
    ykgiksfynl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zlhB (B:)
    mgsshhhhhhssglvprgshmsiitdvyarevldsrgnptlevevytesgafgrgmvpsg
    astgeheavelrdgdksrylglgtqkavdnvnniiakaiigydvrdqqaidramialdgt
    pnkgklganailgvsiavaraaadylevplytylggfntkvlptpmmniinggshsdapi
    afqefmimpvgaptfkeglrwgaevfhalkkilkerglvtavgdeggfapkfegtedgve
    tilkaieaagyeagengimigfdcassefydkerkvydytkfegegaavrtsaeqvdyle
    elvnkypiitiedgmdendwdgwkvlterlgkrvqlvgddffvtnteylargikenaans
    ilikvnqigtltetfeaiemakeagytavvshrsgetedstiadiavatnagqiktgsls
    rtdriakynqllriedqlgevaqykgiksfynlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zlhB (B:)
    hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgastheavelrdgdksrylg
    lgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavara
    aadylevplytylggfntkvlptpmmniinggshsdapiafqefmimpvgaptfkeglrw
    gaevfhalkkilkerglvtavgdeggfapkfegtedgvetilkaieaagyeagengimig
    fdcassefydkerkvydytkfegegaavrtsaeqvdyleelvnkypiitiedgmdendwd
    gwkvlterlgkrvqlvgddffvtnteylargikenaansilikvnqigtltetfeaiema
    keagytavvshrsgetedstiadiavatnagqiktgslsrtdriakynqllriedqlgev
    aqykgiksfynl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zlhC (C:)
    mgsshhhhhhssglvprgshmsiitdvyarevldsrgnptlevevytesgafgrgmvpsg
    astgeheavelrdgdksrylglgtqkavdnvnniiakaiigydvrdqqaidramialdgt
    pnkgklganailgvsiavaraaadylevplytylggfntkvlptpmmniinggshsdapi
    afqefmimpvgaptfkeglrwgaevfhalkkilkerglvtavgdeggfapkfegtedgve
    tilkaieaagyeagengimigfdcassefydkerkvydytkfegegaavrtsaeqvdyle
    elvnkypiitiedgmdendwdgwkvlterlgkrvqlvgddffvtnteylargikenaans
    ilikvnqigtltetfeaiemakeagytavvshrsgetedstiadiavatnagqiktgsls
    rtdriakynqllriedqlgevaqykgiksfynlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zlhC (C:)
    hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgavelrdgdksrylglgtqk
    avdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavaraaadyl
    evplytylggfntkvlptpmmniinggshsdapiafqefmimpvgaptfkeglrwgaevf
    halkkilkerglvtavgdeggfapkfegtedgvetilkaieaagyeagengimigfdcas
    sefydkevydytkfegegaavrtsaeqvdyleelvnkypiitiedgmdendwdgwkvlte
    rlgkrvqlvgddffvtnteylargikenaansilikvnqigtltetfeaiemakeagyta
    vvshrsgetedstiadiavatnagqiktgslsrtdriakynqllriedqlgevaqykgik
    sfynl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zlhD (D:)
    mgsshhhhhhssglvprgshmsiitdvyarevldsrgnptlevevytesgafgrgmvpsg
    astgeheavelrdgdksrylglgtqkavdnvnniiakaiigydvrdqqaidramialdgt
    pnkgklganailgvsiavaraaadylevplytylggfntkvlptpmmniinggshsdapi
    afqefmimpvgaptfkeglrwgaevfhalkkilkerglvtavgdeggfapkfegtedgve
    tilkaieaagyeagengimigfdcassefydkerkvydytkfegegaavrtsaeqvdyle
    elvnkypiitiedgmdendwdgwkvlterlgkrvqlvgddffvtnteylargikenaans
    ilikvnqigtltetfeaiemakeagytavvshrsgetedstiadiavatnagqiktgsls
    rtdriakynqllriedqlgevaqykgiksfynlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zlhD (D:)
    hmsiitdvyarevldsrgnptlevevytesgafgrgmvpsgastgeavelrdgdksrylg
    lgtqkavdnvnniiakaiigydvrdqqaidramialdgtpnkgklganailgvsiavara
    aadylevplytylggfntkvlptpmmniinggshsdapiafqefmimpvgaptfkeglrw
    gaevfhalkkilkerglvtavgdeggfapkfegtedgvetilkaieaagyeagengimig
    fdcassefydkerkvydytkfegegaavrtsaeqvdyleelvnkypiitiedgmdendwd
    gwkvlterlgkrvqlvgddffvtnteylargikenaansilikvnqigtltetfeaiema
    keagytavvshrsgetedstiadiavatnagqiktgslsrtdriakynqllriedqlgev
    aqykgiksfynl