PDB entry 3zl2

View 3zl2 on RCSB PDB site
Description: A thiazolyl-mannoside bound to FimH, orthorhombic space group
Class: cell adhesion
Keywords: cell adhesion, type-1 fimbriae, thiazole, crohn's disease, immunoglobulin
Deposited on 2013-01-27, released 2013-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.1694
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein fimh
  Species: ESCHERICHIA COLI [TaxId:1206108]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08191 (0-157)
  Domains in SCOPe 2.07: d3zl2a_
• Heterogens: BWG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3zl2A (A:)
  facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
  gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
  kagsliavlilrqtnnynsddfqfvwniyanndvvvpt