PDB entry 3zl1

View 3zl1 on RCSB PDB site
Description: A thiazolyl-mannoside bound to FimH, monoclinic space group
Class: cell adhesion
Keywords: cell adhesion, type-1 fimbriae, thiazole, crohn's disease, immunoglobulin
Deposited on 2013-01-27, released 2013-07-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.2316
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein fimh
    Species: ESCHERICHIA COLI [TaxId:1206108]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zl1a_
  • Chain 'B':
    Compound: protein fimh
    Species: ESCHERICHIA COLI [TaxId:1206108]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zl1b_
  • Heterogens: BWG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zl1A (A:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zl1B (B:)
    facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
    gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
    kagsliavlilrqtnnynsddfqfvwniyanndvvvpt