PDB entry 3zks

View 3zks on RCSB PDB site
Description: bace2 xaperone complex with inhibitor
Class: hydrolase/immune system
Keywords: hydrolase-immune system complex, inhibitor, nanobody
Deposited on 2013-01-24, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.21115
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zksa_
  • Chain 'D':
    Compound: xa4813
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZKS (0-End)
    Domains in SCOPe 2.07: d3zksd1, d3zksd2
  • Heterogens: WZV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zksA (A:)
    anflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdter
    sstyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwn
    gilglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggi
    epslykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqk
    vfdavveavaraslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfrit
    ilpqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspca
    eiagaavseisgpfstedvasncvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zksA (A:)
    anflamvdnlqggyylemligtppqklqilvdtgssnfavagtphsyidtyfdterssty
    rskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwngilg
    layatlakpsssletffdslvtqanipnvfsmqmcgggslvlggiepslykgdiwytpik
    eewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveavarasli
    pefsdgfwtgsqlacwtpwsyfpkisiylrdenssrsfritilpqlyiqpmyecyrfgis
    pstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavseisgpfstedvasncvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zksD (D:)
    qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
    adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvsshhhhhhep
    ea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zksD (D:)
    qvqlqesggglvqpggslrlscaasgftfssaimtwvrqapgkgrewvstigsdgsitty
    adsvkgrftisrdnarntlylqmnslkpedtavyyctsagrrgpgtqvtvss