PDB entry 3zkp

View 3zkp on RCSB PDB site
Description: Structure of a mutant of P450 EryK in complex with erythromycin B.
Class: oxidoreductase/antibiotic
Keywords: oxidoreductase-antibiotic complex, catalytic domain, cytochrome p-450 enzyme system, substrate specificity, macrolide antibiotic
Deposited on 2013-01-24, released 2013-05-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.16597
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: erythromycin c-12 hydroxylase
    Species: SACCHAROPOLYSPORA ERYTHRAEA NRRL 2338 [TaxId:405948]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48635 (Start-410)
      • engineered mutation (85)
    Domains in SCOPe 2.03: d3zkpa_
  • Heterogens: HEM, ERB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zkpA (A:)
    mfadvettccarrtlttidevpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvq
    tvlrdtatfssdptrviegasptpgaiheidppehralrkvvssaftprtisdleprird
    vtrslladagesfdlvdvlafplpvtivaellglppmdheqfgdwsgalvdiqmddptdp
    alaeriadvlnpltaylkarcaerradpgddlisrlvlaevdgralddeeaanfstalll
    aghitttvllgnivrtldehpahwdaaaedpgripaiveevlryrppfpqmqrtttkate
    vagvpipadvmvntwvlsanrdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplar
    lenrvaleeiiarfgrltvdrdderlrhfeqivlgtrhlpvlagssprqsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zkpA (A:)
    vpgmadetalldwlgtmrekqpvwqdrygvwhvfrhadvqtvlrdtatfssdptrviega
    sptpgaiheidppehralrkvvssaftprtisdleprirdvtrslladagesfdlvdvla
    fplpvtivaellglppmdheqfgdwsgalvdiqmddptdpalaeriadvlnpltaylkar
    caerradpgddlisrlvlaevdgralddeeaanfstalllaghitttvllgnivrtldeh
    pahwdaaaedpgripaiveevlryrppfpqmqrtttkatevagvpipadvmvntwvlsan
    rdsdahddpdrfdpsrksggaaqlsfghgvhfclgaplarlenrvaleeiiarfgrltvd
    rdderlrhfeqivlgtrhlpvlagssprqsa