PDB entry 3zkn

View 3zkn on RCSB PDB site
Description: bace2 fab inhibitor complex
Class: immune system/hydrolase
Keywords: immune system-hydrolase complex, fab complex
Deposited on 2013-01-23, released 2013-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.20562
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zkna_
  • Chain 'B':
    Compound: Beta-secretase 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zknb_
  • Chain 'C':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZKN (0-End)
  • Chain 'D':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZKN (0-End)
    Domains in SCOPe 2.07: d3zknd1, d3zknd2
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZKN (0-End)
  • Chain 'L':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3ZKN (0-End)
    Domains in SCOPe 2.07: d3zknl1, d3zknl2
  • Heterogens: WZV, DMS, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zknA (A:)
    anflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdter
    sstyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwn
    gilglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggi
    epslykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqk
    vfdavveavaraslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfrit
    ilpqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspca
    eiagaavseisgpfstedvasncvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zknA (A:)
    nflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdters
    styrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwng
    ilglayatlakpsssletffdslvtqanipnvfsmqmcganggslvlggiepslykgdiw
    ytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveava
    raslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqpm
    mgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavsei
    sgpfstedvasncvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zknB (B:)
    anflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdter
    sstyrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwn
    gilglayatlakpsssletffdslvtqanipnvfsmqmcgaglpvagsgtnggslvlggi
    epslykgdiwytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqk
    vfdavveavaraslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfrit
    ilpqlyiqpmmgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspca
    eiagaavseisgpfstedvasncvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zknB (B:)
    nflamvdnlqgdsgrgyylemligtppqklqilvdtgssnfavagtphsyidtyfdters
    styrskgfdvtvkytqgswtgfvgedlvtipkgfntsflvniatifesenfflpgikwng
    ilglayatlakpsssletffdslvtqanipnvfsmqmcganggslvlggiepslykgdiw
    ytpikeewyyqieilkleiggqslnldcreynadkaivdsgttllrlpqkvfdavveava
    raslipefsdgfwtgsqlacwtnsetpwsyfpkisiylrdenssrsfritilpqlyiqpm
    mgaglnyecyrfgispstnalvigatvmegfyvifdraqkrvgfaaspcaeiagaavsei
    sgpfstedvasncvp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3zknD (D:)
    nivlsqspgslavslgqratiscrasksvdtyghsfihwyqqkpgqppnllihlasnles
    gvparfsgrgsgtdftltidpveaddaatyycqqnnedpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zknD (D:)
    nivlsqspgslavslgqratiscrasksvdtyghsfihwyqqkpgqppnllihlasnles
    gvparfsgrgsgtdftltidpveaddaatyycqqnnedpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3zknL (L:)
    nivlsqspgslavslgqratiscrasksvdtyghsfihwyqqkpgqppnllihlasnles
    gvparfsgrgsgtdftltidpveaddaatyycqqnnedpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zknL (L:)
    nivlsqspgslavslgqratiscrasksvdtyghsfihwyqqkpgqppnllihlasnles
    gvparfsgrgsgtdftltidpveaddaatyycqqnnedpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne