PDB entry 3zka

View 3zka on RCSB PDB site
Description: crystal structure of pneumococcal surface antigen psaa d280n in the metal-bound, open state
Class: metal transport
Keywords: metal transport, ATP-binding cassette transporters, bacterial adhesion, carrier proteins, lipoproteins, membrane transport proteins
Deposited on 2013-01-22, released 2013-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.1669
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese abc transporter substrate-binding lipoprotein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4G2 (0-277)
      • engineered mutation (248)
    Domains in SCOPe 2.07: d3zkaa_
  • Chain 'B':
    Compound: manganese abc transporter substrate-binding lipoprotein
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4G2 (0-277)
      • engineered mutation (248)
    Domains in SCOPe 2.07: d3zkab_
  • Heterogens: MN, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zkaA (A:)
    klkvvatnsiiaditkniagdkidlhsivpigqdpheyeplpedvkktseadlifyngin
    letggnawftklvenakktenkdyfavsdgvdviylegqnekgkedphawlnlengiifa
    kniakqlsakdpnnkefyeknlkeytdkldkldkeskdkfnkipaekklivtsegafkyf
    skaygvpsayiweinteeegtpeqiktlveklrqtkvpslfvessvddrpmktvsqdtni
    piyaqiftnsiaeqgkegdsyysmmkynldkiaeglak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zkaB (B:)
    klkvvatnsiiaditkniagdkidlhsivpigqdpheyeplpedvkktseadlifyngin
    letggnawftklvenakktenkdyfavsdgvdviylegqnekgkedphawlnlengiifa
    kniakqlsakdpnnkefyeknlkeytdkldkldkeskdkfnkipaekklivtsegafkyf
    skaygvpsayiweinteeegtpeqiktlveklrqtkvpslfvessvddrpmktvsqdtni
    piyaqiftnsiaeqgkegdsyysmmkynldkiaeglak