PDB entry 3zjk

View 3zjk on RCSB PDB site
Description: crystal structure of Ttb-gly F401S mutant
Class: hydrolase
Keywords: hydrolase, glycoside hydrolase family 1, transglycosidase
Deposited on 2013-01-18, released 2013-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.17539
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta glycosidase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RA61
      • engineered mutation (400)
    Domains in SCOPe 2.06: d3zjka_
  • Chain 'B':
    Compound: beta glycosidase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RA61
      • engineered mutation (400)
    Domains in SCOPe 2.06: d3zjkb_
  • Chain 'C':
    Compound: beta glycosidase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RA61
      • engineered mutation (400)
    Domains in SCOPe 2.06: d3zjkc_
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zjkA (A:)
    mtenaekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrrye
    edialmqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhw
    dlplaleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehap
    glrnleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnr
    ffldpilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvry
    lppegpatamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedperva
    yleahveaalrareegvdlrgyfvwslmdnfewafgytrrsglyyvdfpsqrripkrsal
    wyreriaraqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zjkA (A:)
    ekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrryeedial
    mqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhwdlpla
    leerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglrnl
    eaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnrffldp
    ilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvrylppeg
    patamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedpervayleah
    veaalrareegvdlrgyfvwslmdnfewafgytrrsglyyvdfpsqrripkrsalwyrer
    iara
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zjkB (B:)
    mtenaekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrrye
    edialmqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhw
    dlplaleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehap
    glrnleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnr
    ffldpilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvry
    lppegpatamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedperva
    yleahveaalrareegvdlrgyfvwslmdnfewafgytrrsglyyvdfpsqrripkrsal
    wyreriaraqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zjkB (B:)
    ekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrryeedial
    mqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhwdlpla
    leerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglrnl
    eaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnrffldp
    ilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvrylppeg
    patamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedpervayleah
    veaalrareegvdlrgyfvwslmdnfewafgytrrsglyyvdfpsqrripkrsalwyrer
    iar
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zjkC (C:)
    mtenaekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrrye
    edialmqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhw
    dlplaleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehap
    glrnleaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnr
    ffldpilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvry
    lppegpatamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedperva
    yleahveaalrareegvdlrgyfvwslmdnfewafgytrrsglyyvdfpsqrripkrsal
    wyreriaraqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zjkC (C:)
    aekflwgvatsayqiegatqedgrgpsiwdafaqrpgairdgstgepacdhyrryeedia
    lmqslgvrayrfsvawprilpegrgrinpkglafydrlvdrllasgitpfltlyhwdlpl
    aleerggwrsretafafaeyaeavaraladrvpffatlnepwcsaflghwtgehapglrn
    leaalraahhlllghglavealraagarrvgivlnfapaygedpeavdvadryhnrffld
    pilgkgypespfrdpppvpilsrdlelvarpldflgvnyyapvrvapgtgtlpvrylppe
    gpatamgwevypeglhhllkrlgrevpwplyvtengaaypdlwtgeavvedpervaylea
    hveaalrareegvdlrgyfvwslmdnfewafgytrrsglyyvdfpsqrripkrsalwyre
    riara