PDB entry 3zin

View 3zin on RCSB PDB site
Description: Gu_alpha_helicase
Class: transport protein/hydrolase
Keywords: transport protein-hydrolase complex
Deposited on 2013-01-10, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1799
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zina_
  • Chain 'B':
    Compound: Nucleolar RNA helicase 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JIK5 (1-End)
      • expression tag (0)
  • Chain 'C':
    Compound: Nucleolar RNA helicase 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zinA (A:)
    sgmketaaakferqhmdspdlgtddddkamadigsgtvnwsvedivkginsnnlesqlqa
    tqaarkllsrekqppidniiraglipkfvsflgktdcspiqfesawaltniasgtseqtk
    avvdggaipafisllasphahiseqavwalgniagdgsafrdlvikhgaidpllallavp
    dlstlacgylrnltwtlsnlcrnknpappldaveqilptlvrllhhndpevladscwais
    yltdgpneriemvvkkgvvpqlvkllgatelpivtpalraignivtgtdeqtqkvidaga
    lavfpslltnpktniqkeatwtmsnitagrqdqiqqvvnhglvpflvgvlskadfktqke
    aawaitnytsggtveqivylvhcgiieplmnllsakdtkiiqvildaisnifqaaeklge
    teklsimieecggldkiealqrhenesvykaslnliekyfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zinA (A:)
    gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
    dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
    dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
    ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
    palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
    qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
    kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
    iekyfs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.