PDB entry 3zia

View 3zia on RCSB PDB site
Description: The structure of F1-ATPase from Saccharomyces cerevisiae inhibited by its regulatory protein IF1
Class: hydrolase
Keywords: hydrolase, natural inhibitor, catalysis, intermediate
Deposited on 2013-01-07, released 2013-02-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-03-06, with a file datestamp of 2013-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22618
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP synthase subunit alpha, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP synthase subunit alpha, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP synthase subunit alpha, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ATP synthase subunit beta, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ziad1, d3ziad2, d3ziad3
  • Chain 'E':
    Compound: ATP synthase subunit beta, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ziae1, d3ziae2, d3ziae3
  • Chain 'F':
    Compound: ATP synthase subunit beta, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ziaf1, d3ziaf2, d3ziaf3
  • Chain 'G':
    Compound: ATP synthase subunit gamma, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ziag_
  • Chain 'H':
    Compound: ATP synthase subunit delta, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: ATP synthase subunit epsilon, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: ATPase inhibitor, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01097 (0-End)
      • engineered mutation (20)
  • Chain 'K':
    Compound: ATP synthase subunit alpha, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: ATP synthase subunit alpha, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: ATP synthase subunit alpha, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: ATP synthase subunit beta, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3zian1, d3zian2, d3zian3
  • Chain 'O':
    Compound: ATP synthase subunit beta, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ziao1, d3ziao2, d3ziao3
  • Chain 'P':
    Compound: ATP synthase subunit beta, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ziap1, d3ziap2, d3ziap3
  • Chain 'Q':
    Compound: ATP synthase subunit gamma, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3ziaq_
  • Chain 'R':
    Compound: ATP synthase subunit delta, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: ATP synthase subunit epsilon, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: ATPase inhibitor, mitochondrial
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01097 (0-End)
      • engineered mutation (20)
  • Heterogens: ATP, MG, ADP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ziaD (D:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ziaD (D:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ziaE (E:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ziaE (E:)
    pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
    eglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfaeq
    stsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftgv
    gertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdee
    gqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsv
    qavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqeh
    ydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftgi
    pgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ziaF (F:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ziaF (F:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ziaG (G:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdiitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ziaG (G:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknk
    elivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsin
    gigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieqs
    psfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminry
    silynrtrqavitnelvdiitgass
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3ziaN (N:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ziaN (N:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3ziaO (O:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ziaO (O:)
    pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
    eglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfaeq
    stsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftgv
    gertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdee
    gqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsv
    qavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqeh
    ydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftgi
    pgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3ziaP (P:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ziaP (P:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3ziaQ (Q:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdiitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ziaQ (Q:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknk
    elivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsin
    gigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieqs
    psfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminry
    silynrtrqavitnelvdiitgass
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.