PDB entry 3zgf

View 3zgf on RCSB PDB site
Description: Crystal structure of the Fucosylgalactoside alpha N- acetylgalactosaminyltransferase (GTA, cisAB mutant L266G, G268A) in complex with in complex with NPE caged UDP-Gal (P2(1)2(1)2(1) space group)
Class: transferase
Keywords: transferase, glycosyltransferases
Deposited on 2012-12-17, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.1827
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histo-blood group ABO system transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442 (7-297)
      • engineered mutation (209)
      • engineered mutation (211)
    Domains in SCOPe 2.07: d3zgfa_
  • Chain 'B':
    Compound: Histo-blood group ABO system transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442
      • engineered mutation (209)
      • engineered mutation (211)
    Domains in SCOPe 2.07: d3zgfb_
  • Heterogens: MN, UDP, SO4, IUG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zgfA (A:)
    maigefmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqntti
    gltvfaikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevr
    aykrwqdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgf
    ygssreaftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangi
    eavwhdeshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zgfA (A:)
    vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
    kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
    vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
    ftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhde
    shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zgfB (B:)
    maigefmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqntti
    gltvfaikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevr
    aykrwqdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgf
    ygssreaftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangi
    eavwhdeshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zgfB (B:)
    slprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfaik
    kyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqdv
    smrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssreaf
    tyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhdes
    hlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp