PDB entry 3zfl

View 3zfl on RCSB PDB site
Description: Crystal structure of the V58A mutant of human class alpha glutathione transferase in the apo form
Class: transferase
Keywords: transferase, xenobiotic detoxification, thioredoxin, topologically conserved
Deposited on 2012-12-12, released 2012-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-19, with a file datestamp of 2012-12-14.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.22139
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered mutation (57)
    Domains in SCOPe 2.07: d3zfla1, d3zfla2
  • Chain 'B':
    Compound: glutathione s-transferase a1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08263
      • engineered mutation (57)
    Domains in SCOPe 2.07: d3zflb1, d3zflb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zflA (A:)
    maekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmaei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zflA (A:)
    aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmaeid
    gmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdakl
    alikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpll
    kalktrisnlptvkkflqpgsprkppmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zflB (B:)
    maekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmaei
    dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdak
    lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
    lkalktrisnlptvkkflqpgsprkppmdeksleearkifrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zflB (B:)
    kpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmaeidgm
    klvqtrailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdaklal
    ikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpllka
    lktrisnlptvkkflqpgsprkppmd