PDB entry 3zf3

View 3zf3 on RCSB PDB site
Description: Phage dUTPases control transfer of virulence genes by a proto-oncogenic G protein-like mechanism. (Staphylococcus bacteriophage 80alpha dUTPase Y84I mutant).
Class: hydrolase
Keywords: hydrolase, pathogenicity island, sapi induction, gene transfer, moonlighting proteins, dutpase, dutp, g-protein, p-loop
Deposited on 2012-12-10, released 2013-01-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.23822
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dutpase
    Species: STAPHYLOCOCCUS PHAGE 80ALPHA [TaxId:53369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4ZF98
      • engineered mutation (117)
    Domains in SCOPe 2.04: d3zf3a_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zf3A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsmtntlqvkllsknarmpernhktdag
    ydifsaetvvlepqekaviktdvavsipegyvglltsrsgvsskthlvietgkidagihg
    nlginikndheddkmqtiflrnidnekifekerhlyklgsyriekgeriaqlvivpiwtp
    elkqveefesvsergekgfgssgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zf3A (A:)
    tntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
    tsrsgvsskthlvietgkidagihgnlginikndheddkmqtiflrnidnekifekerhl
    yklgsyriekgeriaqlvivpiwtpelkqveefes