PDB entry 3zdm

View 3zdm on RCSB PDB site
Description: Crystal structure of the Sgt2 N domain and the Get5 UBL domain complex
Class: chaperone/signaling protein
Keywords: chaperone-signaling protein complex
Deposited on 2012-11-29, released 2013-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1887
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: small glutamine-rich tetratricopeptide repeat- containing protein 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12118
• Chain 'B':
  Compound: small glutamine-rich tetratricopeptide repeat- containing protein 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12118
• Chain 'C':
  Compound: ubiquitin-like protein mdy2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12285
  Domains in SCOPe 2.05: d3zdmc_
• Chain 'D':
  Compound: small glutamine-rich tetratricopeptide repeat- containing protein 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12118
• Chain 'E':
  Compound: small glutamine-rich tetratricopeptide repeat- containing protein 2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12118
• Chain 'F':
  Compound: ubiquitin-like protein mdy2
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12285
  Domains in SCOPe 2.05: d3zdmf_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >3zdmC (C:)
  naavhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnl
  flsdlkvtpanstitvmikpn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3zdmC (C:)
  aavhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlf
  lsdlkvtpanstitvmikp
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >3zdmF (F:)
  naavhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnl
  flsdlkvtpanstitvmikpn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3zdmF (F:)
  aavhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlf
  lsdlkvtpanstitvmikp