PDB entry 3zdm

View 3zdm on RCSB PDB site
Description: Crystal structure of the Sgt2 N domain and the Get5 UBL domain complex
Class: chaperone/signaling protein
Keywords: chaperone-signaling protein complex
Deposited on 2012-11-29, released 2013-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1887
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: small glutamine-rich tetratricopeptide repeat- containing protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: small glutamine-rich tetratricopeptide repeat- containing protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ubiquitin-like protein mdy2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdmc_
  • Chain 'D':
    Compound: small glutamine-rich tetratricopeptide repeat- containing protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: small glutamine-rich tetratricopeptide repeat- containing protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: ubiquitin-like protein mdy2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3zdmf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zdmC (C:)
    naavhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnl
    flsdlkvtpanstitvmikpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdmC (C:)
    aavhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlf
    lsdlkvtpanstitvmikp
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3zdmF (F:)
    naavhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnl
    flsdlkvtpanstitvmikpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zdmF (F:)
    aavhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlf
    lsdlkvtpanstitvmikp