PDB entry 3zcs

View 3zcs on RCSB PDB site
Description: Rabbit muscle glycogen phosphorylase b in complex with N-(1-naphthoyl) -N-beta-D-glucopyranosyl urea determined at 2.07 A resolution
Class: transferase
Keywords: transferase, inhibitor, hypoglycaemic agents, structure-based ligand design
Deposited on 2012-11-21, released 2013-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-11, with a file datestamp of 2013-12-06.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.19297
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • engineered mutation (380)
    Domains in SCOPe 2.07: d3zcsa_
  • Heterogens: PLP, IMP, CAW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zcsA (A:)
    msrplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtv
    rdhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldm
    eeleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeea
    ddwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvn
    tmrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfv
    vaatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerl
    dwdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafp
    gdvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkf
    qnktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkq
    enklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvv
    prtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipa
    adlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvd
    rldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyee
    yvkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapde
    kip
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zcsA (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    gyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksstnfdaf
    pdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipealerwpv
    hlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciags
    havngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerige
    eyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkr
    iheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdv
    vnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngalti
    gtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgf
    fspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsg
    kfssdrtiaqyareiwgvepsrqrlpa