PDB entry 3zcm

View 3zcm on RCSB PDB site
Description: Small molecule inhibitors of the LEDGF site of HIV integrase identified by fragment screening and structure based design.
Class: transferase
Keywords: transferase
Deposited on 2012-11-21, released 2012-12-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16572
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv integrase
    Species: Human immunodeficiency virus [TaxId:12721]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q76353
      • engineered mutation (93)
      • engineered mutation (139)
  • Chain 'B':
    Compound: hiv integrase
    Species: Human immunodeficiency virus [TaxId:12721]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q76353
      • engineered mutation (93)
      • engineered mutation (139)
    Domains in SCOPe 2.02: d3zcmb_
  • Heterogens: SO4, GOL, PX3, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zcmB (B:)
    mgsshhhhhhsspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllkla
    grwpvktvhtdngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqv
    rdqaehlktavqmavfihnhkrkggiggysagerivdiiatdiqtke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zcmB (B:)
    spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
    ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
    qmavfihnhkrkgysagerivdiiatdiq