PDB entry 3zc5

View 3zc5 on RCSB PDB site
Description: X-ray Structure of c-Met kinase in complex with inhibitor (S)-6-(1-(6- (1-methyl-1H-pyrazol-4-yl)-(1,2,4)triazolo(4,3-b)pyridazin-3-yl)ethyl) quinoline.
Class: transferase
Keywords: transferase, kinase, inhibitor
Deposited on 2012-11-15, released 2013-11-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3zc5a_
  • Heterogens: W9Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zc5A (A:)
    mvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
    kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
    rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
    ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
    fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehh
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zc5A (A:)
    hidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkkihcavkslnri
    tdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethn
    ptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyy
    svhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvy
    llqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi