PDB entry 3zbx

View 3zbx on RCSB PDB site
Description: X-ray Structure of c-Met kinase in complex with inhibitor 6-((6-(4- fluorophenyl)-(1,2,4)triazolo(4,3-b)(1,2,4)triazin-3-yl)methyl) quinoline.
Class: transferase
Keywords: transferase, inhibitor
Deposited on 2012-11-13, released 2013-11-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zbxa_
  • Heterogens: 6XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zbxA (A:)
    mvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
    kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
    rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
    ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
    fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehh
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zbxA (A:)
    npelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkkihcavkslnritdigevs
    qfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptvkdli
    gfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvhnktg
    aklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrl
    lqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfi