PDB entry 3zbw

View 3zbw on RCSB PDB site
Description: Crystal Structure of murine Angiogenin-3
Class: hydrolase
Keywords: hydrolase, ribonuclease a
Deposited on 2012-11-13, released 2012-12-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1681
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin-3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97802 (Start-120)
      • conflict (61)
    Domains in SCOPe 2.05: d3zbwa_
  • Chain 'B':
    Compound: angiogenin-3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97802 (0-120)
      • conflict (61)
    Domains in SCOPe 2.05: d3zbwb_
  • Heterogens: ACY, SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zbwA (A:)
    qdnyryikfltqhydakptgrdyrycesmmkkrkltspckevntfihdtknnikaicgen
    gnpygvnfrisnsrfqvttcthkggsprppcqynafkdfryiviacedgwpvhfdesfis
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zbwA (A:)
    dnyryikfltqhydakptgrdyrycesmmkkrkltspckevntfihdtknnikaicgeng
    npygvnfrisnsrfqvttcthkggsprppcqynafkdfryiviacedgwpvhfdesfisp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3zbwB (B:)
    qdnyryikfltqhydakptgrdyrycesmmkkrkltspckevntfihdtknnikaicgen
    gnpygvnfrisnsrfqvttcthkggsprppcqynafkdfryiviacedgwpvhfdesfis
    p