PDB entry 3zbv

View 3zbv on RCSB PDB site
Description: Crystal Structure of murine Angiogenin-2
Class: hydrolase
Keywords: hydrolase, ribonuclease a
Deposited on 2012-11-13, released 2012-12-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-01-16, with a file datestamp of 2013-01-11.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.19774
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3zbva_
  • Heterogens: ZN, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zbvA (A:)
    qddsrytkfltqhydakpkgrddrycesmmvkrkltsfckdvntfihdtknnikaicgkk
    gspygrnlriskshfqvttcthkgrsprppcryraskgfryiiigcengwpvhfdesfis
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zbvA (A:)
    dsrytkfltqhydakpkgrddrycesmmvkrkltsfckdvntfihdtknnikaicgkkgs
    pygrnlriskshfqvttcthkgrsprppcryraskgfryiiigcengwpvhfdesfis