PDB entry 3zbt

View 3zbt on RCSB PDB site
Description: ferredoxin-nadp reductase mutant with ser 59 replaced by ala (s59a)
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein
Deposited on 2012-11-13, released 2013-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.19794
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp reductase
    Species: NOSTOC SP. PCC7119 [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-302)
      • engineered mutation (58)
    Domains in SCOPe 2.07: d3zbta1, d3zbta2
  • Heterogens: FAD, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zbtA (A:)
    tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqai
    giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
    lthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpe
    yqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrv
    aehadelwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhv
    ety
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zbtA (A:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqaigiippgvd
    kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelw
    qliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety