PDB entry 3ypi

View 3ypi on RCSB PDB site
Description: electrophilic catalysis in triosephosphase isomerase: the role of histidine-95
Class: isomerase(intramolecular oxidoreductse)
Keywords: isomerase(intramolecular oxidoreductse)
Deposited on 1990-12-31, released 1993-04-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00942 (0-246)
      • conflict (93)
    Domains in SCOPe 2.01: d3ypia_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00942 (0-246)
      • conflict (93)
    Domains in SCOPe 2.01: d3ypib_
  • Heterogens: PGH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ypiA (A:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakwvilgqserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ypiB (B:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakwvilgqserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn