PDB entry 3ypi

View 3ypi on RCSB PDB site
Description: electrophilic catalysis in triosephosphase isomerase: the role of histidine-95
Deposited on 1990-12-31, released 1993-04-15
The last revision prior to the SCOP 1.57 freeze date was dated 1993-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.184
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d3ypia_
  • Chain 'B':
    Domains in SCOP 1.57: d3ypib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ypiA (A:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakwvilgqserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ypiB (B:)
    artffvggnfklngskqsikeiverlntasipenvevvicppatyldysvslvkkpqvtv
    gaqnaylkasgaftgensvdqikdvgakwvilgqserrsyfheddkfiadktkfalgqgv
    gvilcigetleekkagktldvverqlnavleevkdwtnvvvayepvwaigtglaatpeda
    qdihasirkflasklgdkaaselrilyggsangsnavtfkdkadvdgflvggaslkpefv
    diinsrn