PDB entry 3x25

View 3x25 on RCSB PDB site
Description: Crystal structure of Nitrile Hydratase mutant bR56K complexed with Trimethylacetonitrile, photo-activated for 700 min
Class: lyase
Keywords: hydratase, LYASE
Deposited on 2014-12-10, released 2016-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-27, with a file datestamp of 2016-01-22.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase subunit alpha
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: nthA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3x25a_
  • Chain 'B':
    Compound: Nitrile hydratase subunit beta
    Species: Rhodococcus erythropolis [TaxId:1833]
    Gene: nthB, nha2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13449 (0-211)
      • engineered mutation (55)
    Domains in SCOPe 2.07: d3x25b_
  • Heterogens: FE, TAN, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3x25A (A:)
    msvtidhttenaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgael
    varawtdpefrqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpi
    lglpptwyksfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagte
    gwsqeqlqeivtkdcligvaipqvptv
    

    Sequence, based on observed residues (ATOM records): (download)
    >3x25A (A:)
    enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
    frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
    sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
    ivtkdcligvaipqvpt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3x25B (B:)
    mdgvhdlagvqgfgkvphtvnadigptfhaewehlpyslmfagvaelgafsvdevkyvve
    rmeprhymmtpyyeryvigvatlmvekgiltqdeleslaggpfplsrpsesegrpapvet
    ttfevgqrvrvrdeyvpghirmpaycrgrvgtishrttekwpfpdaighgrndageepty
    hvkfaaeelfgsdtdggsvvvdlfegylepaa